PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01873.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 652aa    MW: 73746.8 Da    PI: 6.0363
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01873.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.5e-53141411128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lp GfrF+Ptdeel+++yL+ k++g++le+ +vi+e+d++k+ePwdLp  + +k++++ew+fF++rd+ky++g+r+nrat+ gyWk
  Rsa1.0_01873.1_g00001.1  14 LPLGFRFRPTDEELINHYLRLKINGRDLEV-RVIPEIDVCKWEPWDLPglSVIKTDDQEWFFFCPRDRKYPSGHRSNRATDIGYWK 98 
                              699***************************.99***************6448899999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++++s k+  +g+kktLvfy+grap+ge+t+W+mheyr+
  Rsa1.0_01873.1_g00001.1  99 ATGKDRTIKS-KKMIIGMKKTLVFYRGRAPRGERTNWIMHEYRA 141
                              **********.9999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-645164IPR003441NAC domain
PROSITE profilePS5100558.70214164IPR003441NAC domain
PfamPF023652.1E-2715140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MTTETQATLS METLPLGFRF RPTDEELINH YLRLKINGRD LEVRVIPEID VCKWEPWDLP  60
GLSVIKTDDQ EWFFFCPRDR KYPSGHRSNR ATDIGYWKAT GKDRTIKSKK MIIGMKKTLV  120
FYRGRAPRGE RTNWIMHEYR ATDKDLDGTG PGQNPYVLCR LFHKPSDVAA NCDEVENVNA  180
TPTTTRCSRE DNNNSSDMFQ ETAASRVHAQ NISDDTERCP SDKGSDVKPD DDAPVIKTEK  240
SVDHAETSRA RDRVSGKSIV EESPFARDFS SLYGPSFAQT GDQTYTPATH SSVGFPASHM  300
DSMYSSDFGN CHYGLHFQDG AAIQDESLAD VLDEVFHNQS ASQGKDFALP KMMHWSFPRD  360
TFGFVNGGAT AEASSFPQFV PDVGASRLVS DHHYVDSKEA VEIQSSSGSS RTFTPLHSNV  420
LGQYPPVSYA TMDPFNSNVN QREQSSFEQQ LPVDRNISPN ELNARSRENQ TDLDLLVNQG  480
TAPRRIRLQI EQPFTPVNNE KERDVDNQEE DEVQSAMTKI VEENENSLLD KDKSRAPEHP  540
SLSESRTQGT AHRRIRLQTR IRKLPRAPNN TGRDSDHSEE VETHSKVEKE DVSASSSSSW  600
QKQKRLMRKR LVQCSGMVII MAVMVLLVGI WKESRDAKCS FLFQDSFRGM FT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-4711667170NAC domain-containing protein 19
3swp_C5e-4711667170NAC domain-containing protein 19
3swp_B5e-4711667170NAC domain-containing protein 19
3swp_A5e-4711667170NAC domain-containing protein 19
3swm_D5e-4711667170NAC domain-containing protein 19
3swm_C5e-4711667170NAC domain-containing protein 19
3swm_B5e-4711667170NAC domain-containing protein 19
3swm_A5e-4711667170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382690.0KF738269.1 Brassica napus NAC transcription factor 14 (NAC14.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013637676.10.0PREDICTED: NAC domain-containing protein 14 isoform X2
SwissprotB5X5700.0NAC14_ARATH; NAC domain-containing protein 14
TrEMBLA0A078JK120.0A0A078JK12_BRANA; BnaCnng49700D protein
TrEMBLA0A0D3CGK80.0A0A0D3CGK8_BRAOL; Uncharacterized protein
STRINGBra010193.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.10.0NAC 014